PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G180100.1
Common NameB456_003G180100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 568aa    MW: 63564.7 Da    PI: 6.0887
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G180100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like888.7e-28331384155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k +++WtpeLH++Fv+av+qL G+++A+P++ilelm+v+gLt+++v+SHLQkYR+
  Gorai.003G180100.1 331 KSKVDWTPELHKKFVQAVDQL-GIDQAIPSRILELMEVEGLTRHNVASHLQKYRM 384
                         6799*****************.********************************8 PP

2Response_reg21.41.2e-08501561109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l+ d + + ++ l++ le  +y +v ++ d  ea+  +  +   +++ ++ ++  + +G+  +k +++++ +lp i+ +     +++ ++
  Gorai.003G180100.1  50 ILLLDGDTNSANELKSKLEAMDY-IVYAFHDENEAISAVSSRPesFHVAIVEVSTDNNNGS--FKFLETAK-DLPTIMTSNIHCISTMMKC 136
                         6788888899999999*******.***************666666*************997..67777766.999*99999889******* PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga +fl Kp ++++l++
  Gorai.003G180100.1 137 IARGAVEFLKKPLSEDKLRN 156
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.5E-1446180No hitNo description
SuperFamilySSF521721.99E-1346165IPR011006CheY-like superfamily
PROSITE profilePS5011018.27349162IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.0E-550157IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.63E-651161No hitNo description
PROSITE profilePS5129414.802328387IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-27329387IPR009057Homeodomain-like
SuperFamilySSF466891.43E-18329387IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-25331385IPR006447Myb domain, plants
PfamPF002492.1E-7334383IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MKWGFSMILI FFNVICNTWW LLKKGCHKPA MVCTANDLST WKDFPKGLKI LLLDGDTNSA  60
NELKSKLEAM DYIVYAFHDE NEAISAVSSR PESFHVAIVE VSTDNNNGSF KFLETAKDLP  120
TIMTSNIHCI STMMKCIARG AVEFLKKPLS EDKLRNIWQH VVHKAFNTGG NDLTESLKPV  180
KESVVSMLQQ QPENLKPKNE DSETTEDASM IHENDSEPPA GNDKYPAPST PQLEQGGRLL  240
DDRDCQDHTH CSIEKESGDQ DGETESVETT GGNTTATGGQ PRGPSETNVK EEDDSVDGTM  300
GESPQNRVDS KGSDVVAEKP SSCPDKANRK KSKVDWTPEL HKKFVQAVDQ LGIDQAIPSR  360
ILELMEVEGL TRHNVASHLQ KYRMQRRHIL PKDDDRRWLQ RPQTQRICNY PHKPIMAFPP  420
YNHVPVGPVY PMWRAPSHPP TIQMWGTQGY PPWQPTESWH WKPYPGVQAD AWGCPVMPPP  480
QGYFSTFPQN ASGFQPCNVD KRNGMPQTLA EHHPEEEVID KMVKEAINKP GLPLPLGLKP  540
PSTDSVLAEL YRQGISTVPP HINASDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-17329389363ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5816581e-122JX581658.1 Gossypium hirsutum clone NBRI_GE14330 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472126.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_012472127.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
SwissprotQ6LA431e-146APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0D2RPM50.0A0A0D2RPM5_G
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57462747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-146ARR-B family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]